Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand) protein, AF

Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which is encoded by the Flt3lg gene in mouse. As an important regulator of hematopoiesis, Flt-3 ligand has a tyrosine-protein kinase activity that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt-3 ligand can synergistically increase the proliferation of immature progenitors with other cytokines such as GM-CSF, G-CSF, IL-3, EPO, IL-11, IL-12, IL-6 or TPO. Flt-3 ligand is expressed by a variety of hematopoietic progenitor cells including immature hematopoietic and marrow stromal cells.

Product Specifications

Synonyms

Fetal liver kinase 2, FLK-2

Gene Name

FLT3LG

UniProt

P49772

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is <2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.3 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details