Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant GDNF (Glial-derived neurotrophic factor) protein, AF

Glial Cell Line-derived Neurotrophic Factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.

Product Specifications

Synonyms

AI385739, ATF

Gene Name

GDNF

UniProt

P48540

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.91 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF701 activation kit by CRISPRa
GA110948 1 Kit

Human ZNF701 activation kit by CRISPRa

Sign In for Pricing
View Details
LSM14A Human qPCR Primer Pair (NM_015578)
HP228064 200 Reactions

LSM14A Human qPCR Primer Pair (NM_015578)

Sign In for Pricing
View Details
Recombinant Human TRAIL R2/TNFRSF10B Protein (Fc & His Tag)
PKSH033127-01 10 µg

Recombinant Human TRAIL R2/TNFRSF10B Protein (Fc & His Tag)

Sign In for Pricing
View Details
Recombinant Human TRAIL R2/TNFRSF10B Protein (Fc & His Tag)
PKSH033127-02 50 µg

Recombinant Human TRAIL R2/TNFRSF10B Protein (Fc & His Tag)

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Anti-GS-ll Antibody
BAL-2402-2 2 mL

Biotin Conjugated Rabbit Anti-GS-ll Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS702758 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details