Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-15 (Interleukin-15) protein, AF

Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.

Product Specifications

Synonyms

IL-T

Gene Name

Il15

UniProt

P48346

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce CTLL-2 cells proliferation. The ED50 for this effect is <10 ng/mL. The specific activity of recombinant mouse IL-15 is approximately >1x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution of Proleukin buffer, pH 7.5.containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.2 kDa. The protein migrates as 11-14 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS with polyhistidine tag at the N-terminus.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin, CD227, Mucin-1 subunit alpha, Mucin-1 subunit beta, MUC1-CT) (MaxLight 405) discontinued
038691-ML405 100 µL

MUC1/EMA, CT (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin, CD227, Mucin-1 subunit alpha, Mucin-1 subunit beta, MUC1-CT) (MaxLight 405) discontinued

Ask
View Details
Olfr1120 (NM_147029) Mouse Tagged ORF Clone Lentiviral Particle
MR214042L4V 200 µL

Olfr1120 (NM_147029) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
DDX18 Antibody
DF9258-01 100 µL

DDX18 Antibody

Ask
View Details
DDX18 Antibody
DF9258-02 200 µL

DDX18 Antibody

Ask
View Details
Caveolin-1, Rat, mAb 7C8
MBS584149-01 0.1 mg

Caveolin-1, Rat, mAb 7C8

Ask
View Details
Caveolin-1, Rat, mAb 7C8
MBS584149-02 5x 0.1 mg

Caveolin-1, Rat, mAb 7C8

Ask
View Details