Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-11 (Interleukin-11) protein, AF

Interleukin 11 (IL-11) is a cytokine, encoded by the gp130 family genes. IL-11 initially thought to be important for hematopoiesis, notably for megakaryocyte maturation, and it facilitates the formation of higher order structures involving dimers of gp130 / IL-11 / IL-11RA complexes.

Product Specifications

Synonyms

AGIF (Adipogenesis Inhibitory Factor)

Gene Name

Il11

UniProt

P47873

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IL-11 is > 2 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.96 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF460 Antibody
8C19600-AAT 50 µg

ZNF460 Antibody

Sign In for Pricing
View Details
ALDH1A3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B6]
TA502805AM 100 µL

ALDH1A3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B6]

Sign In for Pricing
View Details
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF405S conjugate, 0.1mg/mL
BNC043635-100 1x 100 µL

Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
cis-1,3,3-Trichloro-1-propene (cis-trans mixture, ~70% Z)
TRC-T773945-2.5MG 2.5 mg

cis-1,3,3-Trichloro-1-propene (cis-trans mixture, ~70% Z)

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF568 conjugate, 0.1mg/mL
BNC682010-500 1x 500 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Thiooxamate
TRC-E926850-1G 1 g

Ethyl Thiooxamate

Sign In for Pricing
View Details