Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant OX40L protein, AF

OX40L is a 16.86 kDa tumor necrosis factor family protein with 150 amino acid residues. OX40L is mainly expressed from lymphoid tissue, and promotes T-cell proliferation, survival, activation and cytokine production through receptor binding on the surface of T cells (OX40) .

Product Specifications

Synonyms

TNFSF4, Ath, Ath-, Ath-1, Ath1, CD134, CD134L, OX-40L, OX4, TXGP1, Tnlg2b, Txgp, Txgp1l, gp3, gp34

Gene Name

TNFSF4

UniProt

P43488

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <25 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 17.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FBXO31 activation kit by CRISPRa
GA112628 1 Kit

Human FBXO31 activation kit by CRISPRa

Sign In for Pricing
View Details
Buccutite™ Rapid PE Antibody Labeling Kit *Microscale Optimized for Labeling 25 ug Antibody Per Reaction*
1312-AAT 2 Labelings

Buccutite™ Rapid PE Antibody Labeling Kit *Microscale Optimized for Labeling 25 ug Antibody Per Reaction*

Sign In for Pricing
View Details
Human IL17RA/CD217, C-His Tag (ECD)
HA210581-01 20 µg

Human IL17RA/CD217, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IL17RA/CD217, C-His Tag (ECD)
HA210581-02 50 µg

Human IL17RA/CD217, C-His Tag (ECD)

Sign In for Pricing
View Details
Human IL17RA/CD217, C-His Tag (ECD)
HA210581-03 100 µg

Human IL17RA/CD217, C-His Tag (ECD)

Sign In for Pricing
View Details
EGR2 (NM_001136179) Human Over-expression Lysate
LY427837 100 µg

EGR2 (NM_001136179) Human Over-expression Lysate

Sign In for Pricing
View Details