Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine recombinant CCL2 (C-C Motif Chemokine Ligand 2) protein, AF

CCL2 (Chemokine ligand 2) is also named for the MCP1 (monocyte chemoattractant protein 1) which is a cytokine of CC chemokine family. CCL2 plays an important role in the recruitment of T cell and monocyte during inflammation, which is induced by the infection. CCL2 is secreted from the osteoblasts which is under the mediation of the NF-κB pathway. In cancer therapy, CCL2 plays an important role in increasing the anti-tumor capability of monocytes and neutrophils.

Product Specifications

Synonyms

MCP-1

Gene Name

CCL2

UniProt

P42831

Reactivity

Swine

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.42 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

QPDAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKQKWVQDSISHLDKKNQTPKP with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIC8 (RIC8A) Goat Polyclonal Antibody
TA302971 100 µg

RIC8 (RIC8A) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Coliform Broth w/ SLS
M1826-500G 500 g

Coliform Broth w/ SLS

Sign In for Pricing
View Details
SPTBN2 AAV siRNA Pooled Vector
45417161 1.0 µg

SPTBN2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (AP) discontinued
132947-AP 100 µL

SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (AP) discontinued

Sign In for Pricing
View Details
Mucl1 3'UTR GFP Stable Cell Line
TU163626 1.0 mL

Mucl1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
UGT2B15 (UDP-glucuronosyltransferase 2B15, UDPGT 2B15, UDPGT2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGT 2B8, UGT2B8, UDPGTH3, UDPGTh-3) (MaxLight 490)
135077-ML490 100 µL

UGT2B15 (UDP-glucuronosyltransferase 2B15, UDPGT 2B15, UDPGT2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGT 2B8, UGT2B8, UDPGTH3, UDPGTh-3) (MaxLight 490)

Sign In for Pricing
View Details