Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL5 (C-X-C motif chemokine 5) protein, AF

C-X-C motif chemokine 5 (CXCL5) also named epithelial-derived neutrophil-activating peptide 78 (ENA-78), which is a chemokine of the intercrine alpha family. CXCL5 is a 8kDa protein containing 70 amino acid residues. CXCL5 is stimulated by the IL-1 or TNFα during inflammation which produced by the eosinophils and CXCL5 is inhibited by the IFNγ. CXCL5 promotes the formation of blood vessels and angiogenesis by binding the cell receptor CXCR2.

Product Specifications

Synonyms

Epithelial Neutrophil Activating Peptide-78, ENA-78

Gene Name

CXCL5

UniProt

P42830

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <10 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.51 kDa. The protein migrates as 12 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 AIP1 (TP53AIP1) (NM_001195194) Human Over-expression Lysate
LY433953 100 µg

p53 AIP1 (TP53AIP1) (NM_001195194) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM61 Protein Vector (Human) (pPM-C-His)
PV042980 500 ng

TMEM61 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Tin(Iv) Chloride Pentahydrate
abx186005 100 g

Tin(Iv) Chloride Pentahydrate

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 6 Antibody (KRT6/8267R) [DyLight 680]
NBP3-24260FR 0.1 mL

Rabbit Monoclonal Cytokeratin 6 Antibody (KRT6/8267R) [DyLight 680]

Sign In for Pricing
View Details
Human MIR3973 qPCR Primer Pair
QH85241S 200 Tests

Human MIR3973 qPCR Primer Pair

Sign In for Pricing
View Details
OVOS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV812662 1.0 µg DNA

OVOS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details