Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant 4-1BBL (4-1BB ligand) protein, AF

4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation. Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer.

Product Specifications

Synonyms

CD137L, TNLG5A, TNFSF9, Tumor necrosis factor ligand superfamily member 9

Gene Name

TNFSF9

UniProt

P41273

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is 1-5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.4 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PD-L1 Antibody Pair Set
E-KAB-0463 50 µL & 100 µg

Human PD-L1 Antibody Pair Set

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell Helper,  5nm
GM-06-5 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell Helper, 5nm

Sign In for Pricing
View Details
MAK Mouse Monoclonal Antibody [Clone ID: OTI5A7]
CF808843 100 µg

MAK Mouse Monoclonal Antibody [Clone ID: OTI5A7]

Sign In for Pricing
View Details
Human RWDD1 activation kit by CRISPRa
GA109784 1 Kit

Human RWDD1 activation kit by CRISPRa

Sign In for Pricing
View Details
C3orf78 (SMIM4) (NM_001124767) Human Over-expression Lysate
LC426629 20 µg

C3orf78 (SMIM4) (NM_001124767) Human Over-expression Lysate

Sign In for Pricing
View Details
Ptp4a1 (BC086787) Mouse Tagged ORF Clone
MG201475 10 µg

Ptp4a1 (BC086787) Mouse Tagged ORF Clone

Sign In for Pricing
View Details