Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant FasL (Fas ligand) protein, AF

Fas Ligand (FasL) is a 17.34 kDa tumor necrosis factor with 152 amino acid residues. FasL is mainly expressed from lymphoid tissue and secreted to blood. Binding to its receptor, TNFRSF6/FAS, leads to induce apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development.

Product Specifications

Synonyms

Soluble Fas Ligand (sFasL), TNFSF6, CD95L, Apo I Ligand, APTL, APT1LG1, CD178, Fas-Lg, Tnfs, Tnlg1a, gld

Gene Name

FASLG

UniProt

P41047

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce apoptosis in Jurkat cells. The ED50 for this effect is <1 μg /mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.27 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

QIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL with polyhistidine tag at the N-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Caspase-3 Monoclonal Antibody
MBS8519611-01 0.1 mg

Active Caspase-3 Monoclonal Antibody

Sign In for Pricing
View Details
Active Caspase-3 Monoclonal Antibody
MBS8519611-02 0.1 mL (AF635)

Active Caspase-3 Monoclonal Antibody

Sign In for Pricing
View Details
Active Caspase-3 Monoclonal Antibody
MBS8519611-03 0.1 mL (AF610)

Active Caspase-3 Monoclonal Antibody

Sign In for Pricing
View Details
Active Caspase-3 Monoclonal Antibody
MBS8519611-04 0.1 mL (AF405S)

Active Caspase-3 Monoclonal Antibody

Sign In for Pricing
View Details
Active Caspase-3 Monoclonal Antibody
MBS8519611-05 0.1 mL (AF405L)

Active Caspase-3 Monoclonal Antibody

Sign In for Pricing
View Details
Active Caspase-3 Monoclonal Antibody
MBS8519611-06 0.1 mL (AF546)

Active Caspase-3 Monoclonal Antibody

Sign In for Pricing
View Details