Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-15 (Interleukin-15) protein, AF

Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.

Product Specifications

Synonyms

IL-T

Gene Name

IL15

UniProt

P40933

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in CTLL-2 cells. The ED50 for this effect is < 3 ng/mL. The specific activity of recombinant human IL-15 is > 2 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution of NaPi buffer, 0.018% SDS, pH 7.5.containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.7 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFIN TS with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cep250 Mouse Gene Knockout Kit (CRISPR)
KN503157 1 Kit

Cep250 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE,  40nm
GAF-005-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE, 40nm

Sign In for Pricing
View Details
Glutamic Acid (Glu) Colorimetric Assay Kit
E-BC-K903-M-01 48 T (32 samples)

Glutamic Acid (Glu) Colorimetric Assay Kit

Sign In for Pricing
View Details
Glutamic Acid (Glu) Colorimetric Assay Kit
E-BC-K903-M-02 96 T (80 samples)

Glutamic Acid (Glu) Colorimetric Assay Kit

Sign In for Pricing
View Details
COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p
TM67200 500 Reactions

COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p

Sign In for Pricing
View Details
CACNB4 (NM_000726) Human Over-expression Lysate
LC400240 20 µg

CACNB4 (NM_000726) Human Over-expression Lysate

Sign In for Pricing
View Details