Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-8b (Bone morphogenetic protein-8b) protein, AF

Bone Morphogenetic Protein-8B (BMP-8B) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-8B can bind with the TGF-β receptor and is involved in SMAD protein signal transduction. BMP-8B plays a role in bone and cartilage development. It is expressed in brown adipose tissues and the hypothalamus, which can affect thermogenesis and susceptibility to obesity.

Product Specifications

Synonyms

OP-2 (Osteogenic Protein-2), BMP8

Gene Name

BMP8B

UniProt

P34820

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <21.8 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.48 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

AVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit
CSB-EL005161HU-01 24 Well

Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit

Sign In for Pricing
View Details
Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit
CSB-EL005161HU-02 96 Well

Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit

Sign In for Pricing
View Details
Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit
CSB-EL005161HU-03 5x 96 Well

Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit

Sign In for Pricing
View Details
Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit
CSB-EL005161HU-04 10x 96 Well

Human Carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20) ELISA kit

Sign In for Pricing
View Details
PSMA1 antibody (Ser250)
70R-36600 0.1 mg

PSMA1 antibody (Ser250)

Sign In for Pricing
View Details
All-cis-4,7,10,13,16-Docosapentaenoic acid
sc-227224 25 mg

All-cis-4,7,10,13,16-Docosapentaenoic acid

Sign In for Pricing
View Details