Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CD30L (CD30 ligand) protein, AF

Human CD30L is also named for CD153 and TNFSF8 which is one member of TNF family. Human CD30L is expressed on T cells. It binds the CD30, which is on some lymphoma cell lines. Human CD30L is a 30 kDa cytokine with 171 amino acid residues which is a transmembrane glycoprotein. Human CD30L plays an important role in the regulation of cell proliferation, activation and apoptosis. Human CD30L is a good target of cell therapy in inflammatory diseases.

Product Specifications

Synonyms

Soluble CD30 Ligand, TNFSF8, CD153, sCD30 Ligand

Gene Name

TNFSF8

UniProt

P32971

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMCs using a concentration range of 10 - 100 ng/mL. Note: Results may vary from different PBMC donors.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.57 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JLP (SPAG9) Human Gene Knockout Kit (CRISPR)
KN417252 1 Kit

JLP (SPAG9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP20334PU-N 100 µg

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL-3 Protein (Trx Tag)
PDEM100196-01 20 µg

Recombinant Mouse IL-3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-3 Protein (Trx Tag)
PDEM100196-02 100 µg

Recombinant Mouse IL-3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-3 Protein (Trx Tag)
PDEM100196-03 500 µg

Recombinant Mouse IL-3 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-3 Protein (Trx Tag)
PDEM100196-04 1 mg

Recombinant Mouse IL-3 Protein (Trx Tag)

Sign In for Pricing
View Details