Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human (mammalian cell expression) recombinant HMGB2 protein, AF

High Mobility Group protein B2, also known as HMGB2, is a member of the non-histone chromosomal high-mobility group protein family. HMGB2 is expressed 25 kDa containing 209 amino acid residues. The function of HMGB2 is involved in transcription, chromatin remodeling and V (D) J recombination. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles .

Product Specifications

Synonyms

HMG2

Gene Name

HMGB2

UniProt

P26583

Reactivity

Human

Tag

His-SUMO Tag (N-term)

Source

HEK293 cell

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 35.57 kDa. The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE with polyhistidine-SUMO tag at the N-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit
MBS9326394-01 48 Well

Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit

Sign In for Pricing
View Details
Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit
MBS9326394-02 96 Well

Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit

Sign In for Pricing
View Details
Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit
MBS9326394-03 5x 96 Well

Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit

Sign In for Pricing
View Details
Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit
MBS9326394-04 10x 96 Well

Mouse Prolactin regulatory element-binding protein, PREB ELISA Kit

Sign In for Pricing
View Details
Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) ELISA Kit
RD-INPP4A-Hu-48Tests 48 Tests

Human Inositol Polyphosphate-4-Phosphatase Type I 107kDa (INPP4A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Histidine Rich Glycoprotein (HRG)
SIPC306Mu02-01 10 µg

Recombinant Histidine Rich Glycoprotein (HRG)

Sign In for Pricing
View Details