Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CNTF (Ciliary neurotrophic factor) protein, AF

Ciliary neurotrophic factor (CNTF) is the member of IL-6 cytokine family and expressed in the nervous system. CNTF is 22.9 kDa neurotrophic factor containing 200 residues, which shows multiple effects in vertebrate retinogenesis. Besides, CNTF acts as a promoter that not only accelerates adult neurogenesis but also increases the survival of neuron after injury. On the other hands, reducing number of hippocampal GABAergic interneurons, as well as 5-HT levels and 5-HT1A receptor expression has been found in CNTF knockout female mice, indicating that CNTF may influence affective behavior in females by regulation of neurotransmission.

Product Specifications

Synonyms

HCNTF

Gene Name

CNTF

UniProt

P26441

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.15 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 23.74 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFD6 (PFDN6) (NM_014260) Human Over-expression Lysate
LH09090V 100 µg

PFD6 (PFDN6) (NM_014260) Human Over-expression Lysate

Sign In for Pricing
View Details
GPNMB Mouse Monoclonal Antibody [Clone ID: OTI2F9]
TA807745S 30 µL

GPNMB Mouse Monoclonal Antibody [Clone ID: OTI2F9]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YJBS Polyclonal Antibody
MBS7160795 Inquire

Rabbit anti-Escherichia coli (strain K12) YJBS Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal NuMA Antibody (12A11)
NBP3-26451-50ul 50 µL

Rabbit Monoclonal NuMA Antibody (12A11)

Sign In for Pricing
View Details
Human Netrin-4 (Ntn4) ELISA Kit
MBS2611511-01 48 Well

Human Netrin-4 (Ntn4) ELISA Kit

Sign In for Pricing
View Details
Human Netrin-4 (Ntn4) ELISA Kit
MBS2611511-02 96 Well

Human Netrin-4 (Ntn4) ELISA Kit

Sign In for Pricing
View Details