Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-6 (Bone morphogenetic protein-6) protein, AF

Bone Morphogenetic Protein-6 (BMP-6) is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-6 can bind with the TGF-β receptor and triggers SMAD protein signal transduction. It can keep joint integrity and stability in adults and plays a vital role in regulating hepcidin to maintain iron ions in the body.

Product Specifications

Synonyms

VGR, VG-1-related protein

Gene Name

BMP6

UniProt

P22004

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <87 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1xPBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.07 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALS2CR1 (NIF3L1) (NM_001142355) Human Over-expression Lysate
LY428055 100 µg

ALS2CR1 (NIF3L1) (NM_001142355) Human Over-expression Lysate

Sign In for Pricing
View Details
Dctn5 (NM_021608) Mouse Tagged ORF Clone
MG201654 10 µg

Dctn5 (NM_021608) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ACLY Antibody
KC-3910-01 50 μL

ACLY Antibody

Sign In for Pricing
View Details
ACLY Antibody
KC-3910-02 100 µL

ACLY Antibody

Sign In for Pricing
View Details
ACLY Antibody
KC-3910-03 1 mL

ACLY Antibody

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF647 conjugate, 0.1mg/mL
BNC471970-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details