Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-5 (Bone morphogenetic protein-5) protein, AF

Bone Morphogenetic Protein-5 (BMP-5) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-5 can bind with TGF-β receptors and trigger SMAD protein signal transduction. It is involved in many negatively regulated physiological processes, such as the aldosterone biosynthetic process and epithelial to mesenchymal transition. BMP-5 also plays a vital role in cartilage synthesis.

Product Specifications

Gene Name

BMP5

UniProt

P22003

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <0.17 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.57 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

BTG2 Antibody - N-terminal region
ARP33560_P050-25UL 25 µL

BTG2 Antibody - N-terminal region

Sign In for Pricing
View Details
Human Kinase Library II
HKIN-II 1 set

Human Kinase Library II

Sign In for Pricing
View Details
1-Hexaneboronic acid, cyclic iminodiethylene ester
OR1095483 1 Each

1-Hexaneboronic acid, cyclic iminodiethylene ester

Sign In for Pricing
View Details
F9 Rabbit Polyclonal Antibody
E10G07652 100 µL

F9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SULt4a1 Mouse Gene Knockout Kit (CRISPR)
KN516975 1 Kit

SULt4a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ephrin-A2 (m) -PR
sc-39429-PR 10 µM - 20 µL

Ephrin-A2 (m) -PR

Sign In for Pricing
View Details