Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant SCF protein, AF

Stem Cell Factor (SCF) is a 166-amino-acid protein with a monomeric molecular weight of approximately 18.5 kDa. SCF is the ligand for the tyrosine kinase receptor c-kit, which regulates other Growth Factorss, such as granulocyte colony-stimulating factor (G-CSF), granulocyte macrophage-colony-stimulating factor (GM-CSF), and interleukin-3 to stimulate proliferation, and differentiation of hematopoietic stem cells. SCF can be produced by a variety of cells, including fibroblasts, smooth muscle, endothelial cells, mast cells and bone marrow macrophages endothelial cells.

Product Specifications

Synonyms

DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SF, SHEP7, SLF, KIT ligand

Gene Name

KITLG

UniProt

P21583

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <5 ng/mL. The specific activity of recombinant human SCF is > 5 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.4 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) (C68/2908R), CF647 conjugate, 0.1mg/mL
BNC472908-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2908R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL
BNCB1386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human UCHL1/PGP9.5 Protein (His Tag)
PKSH031037 50 µg

Recombinant Human UCHL1/PGP9.5 Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF568 conjugate, 0.1mg/mL
BNC680020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UP-02 100 µg

PE/Elab Fluor® 594 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details