Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-11 (Interleukin-11) protein, AF

Interleukin 11 (IL-11) is a cytokine, encoded by the gp130 family genes. IL-11 initially thought to be important for hematopoiesis, notably for megakaryocyte maturation, and it facilitate the formation of higher order structures involving dimers of gp130: IL-11:IL-11 RA complexes.

Product Specifications

Synonyms

AGIF (Adipogenesis Inhibitory Factor)

Gene Name

IL11

UniProt

P20809

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce T11 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human IL-11 is approximately >1 x 107 IU/ mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.95 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOBOX (NM_001080413) Human Over-expression Lysate
LY421630 100 µg

NOBOX (NM_001080413) Human Over-expression Lysate

Sign In for Pricing
View Details
Ku70/80 Antibody
8C0252-AAT 50 µg

Ku70/80 Antibody

Sign In for Pricing
View Details
Synapsin I (SYN1) Rabbit Polyclonal Antibody
AP02760PU-N 100 µL

Synapsin I (SYN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NQO1 Recombinant Mouse monoclonal Antibody
HA610087 100 µg

NQO1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
EIDD 2801-D7
TRC-E985797-1MG 1 mg

EIDD 2801-D7

Sign In for Pricing
View Details
myosin heavy chain 9 (MYH9) Rabbit Polyclonal Antibody
TA378838 100 µL

myosin heavy chain 9 (MYH9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details