Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF

C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55 kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responsed for IFNγ. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induces the cell migration and activation like T cells and dendritic cells.

Product Specifications

Synonyms

IP-10, Gamma-Interferon Inducible Protein 10, Crg-2

Gene Name

CXCL10

UniProt

P17515

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is <0.2 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.47 kDa. The protein migrates as 7-11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Kynureninase (KYNU) ELISA Kit
MBS2600931-01 48 Well

Rat Kynureninase (KYNU) ELISA Kit

Sign In for Pricing
View Details
Rat Kynureninase (KYNU) ELISA Kit
MBS2600931-02 96 Well

Rat Kynureninase (KYNU) ELISA Kit

Sign In for Pricing
View Details
Rat Kynureninase (KYNU) ELISA Kit
MBS2600931-03 5x 96 Well

Rat Kynureninase (KYNU) ELISA Kit

Sign In for Pricing
View Details
Rat Kynureninase (KYNU) ELISA Kit
MBS2600931-04 10x 96 Well

Rat Kynureninase (KYNU) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human FAM32A shRNA (UAS) - Lentiviral human FAM32A shRNA (UAS, GFP) plasmid
GTR15127330 1 Vial

Lentiviral human FAM32A shRNA (UAS) - Lentiviral human FAM32A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human Optineurin (OPTN) ELISA Kit
RD-OPTN-Hu-96Tests 96 Tests

Human Optineurin (OPTN) ELISA Kit

Sign In for Pricing
View Details