Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant FGF-2 (Fibroblast growth factor-basic) protein, AF

Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.

Product Specifications

Synonyms

HBGF-2, Prostatropin

Gene Name

Fgf2

UniProt

P15655/P13109

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <1.5 ng/mL. The specific activity of recombinant mouse FGF-2 is approximately >1 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 0.01% sarkosyl in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 17.2 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken LRP6 ELISA Kit
ECKL0286 96 Tests

Chicken LRP6 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SDF-1 alpha
(rHuSDF-1 alpha/CXCL12- alpha)
JOT-PR1112 2µg

Recombinant Human SDF-1 alpha (rHuSDF-1 alpha/CXCL12- alpha)

Sign In for Pricing
View Details
EPN3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV703627 1.0 µg DNA

EPN3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CD31 Monoclonal Antibody, Cy3 Conjugated
bsm-10825M-Cy3-TR 20 µL

CD31 Monoclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Botin-Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)
MBS2110469-01 0.1 mL

Botin-Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)

Sign In for Pricing
View Details
Botin-Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)
MBS2110469-02 0.2 mL

Botin-Linked Monoclonal Antibody to Microtubule Associated Protein RP/EB Family, Member 1 (MAPRE1)

Sign In for Pricing
View Details