Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-9 (Interleukin-9) protein, AF

Interleukin 9, also known as IL-9, is a pleiotropic cytokine (cell signalling molecule) belonging to the group of interleukins. IL-9 is produced by variety of cells like mast cells, NKT cells, Th2, Th17, Treg, ILC2, and Th9 cells in different amounts. Among them, Th9 cells are regarded as the major CD4+ T cells that produce IL-9.

Product Specifications

Synonyms

P40 cytokine, T-cell growth factor p40

Gene Name

IL9

UniProt

P15247

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

14.97 kDa

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

QRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRH Rabbit Polyclonal Antibody
TA365201 100 µL

UQCRH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS700064 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Human ADAMTS18 activation kit by CRISPRa
GA116224 1 Kit

Human ADAMTS18 activation kit by CRISPRa

Sign In for Pricing
View Details
C2orf3 (GCFC2) (NM_003203) Human Over-expression Lysate
LY418836 100 µg

C2orf3 (GCFC2) (NM_003203) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FAM217B activation kit by CRISPRa
GA111928 1 Kit

Human FAM217B activation kit by CRISPRa

Sign In for Pricing
View Details
Human SPATA31C2 activation kit by CRISPRa
GA118769 1 Kit

Human SPATA31C2 activation kit by CRISPRa

Sign In for Pricing
View Details