Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CCL4 (C-C motif chemokine ligand 4) protein, AF

C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells and epithelial cells. CCL4 recruits various immune cells like natural killer cells, monocytes, and neutrophils when CCL4 binds to CCR5. In addition, CCL4 mediates lymphocyte adhesion by Rac1 /Cdc42 signaling pathway and plays critical roles in different biological functions like maintenance of cell polarity, regulation of calcium ion transport and response to viruses.

Product Specifications

Synonyms

MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2

Gene Name

CCL4

UniProt

P13236

Reactivity

Human

Tag

Tag Free

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is <10 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 7.75 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Parvalbumin
MBS144289-01 0.005 mg

Recombinant Human Parvalbumin

Sign In for Pricing
View Details
Recombinant Human Parvalbumin
MBS144289-02 0.025 mg

Recombinant Human Parvalbumin

Sign In for Pricing
View Details
Recombinant Human Parvalbumin
MBS144289-03 1 mg

Recombinant Human Parvalbumin

Sign In for Pricing
View Details
Recombinant Human Parvalbumin
MBS144289-04 5x 1 mg

Recombinant Human Parvalbumin

Sign In for Pricing
View Details
Rxrg sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3778808 1.0 µg DNA

Rxrg sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei iscA Protein (aa 1-107)
VAng-Lsx09797-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei iscA Protein (aa 1-107)

Sign In for Pricing
View Details