Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant Midkine protein, AF

Midkine, also known as neurite growth-promoting factor 2 (NEGF2) is a member of a small family of secreted Growth Factorss, furthermore high expression in embryo, and limb E14.5. Mouse midkine shares 87% sequence identity with human midkine. Midkine is a 13.5 kDa protein containing 140 amino acids, which promotes angiogenesis, cell growth, migration, and gene expression of different cell types probably via a multiprotein receptor complex consisting of several molecules.

Product Specifications

Synonyms

MK, NEGF-2, Mek

Gene Name

MDK

UniProt

P12025

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 14.02 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM169 (NM_001142310) Human Tagged ORF Clone Lentiviral Particle
RC227010L3V 200 µL

TMEM169 (NM_001142310) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr217 AAV siRNA Pooled Vector
34231166 1.0 µg

Olr217 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ARF5 Antibody, Biotin conjugated
A22521-50UG 50 µg

ARF5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MAT1A Rabbit Polyclonal Antibody (BF680)
orb2477452 100 µL

MAT1A Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
FAM101A (RFLNA) (NM_181709) Human Recombinant Protein
TP761712 50 µg

FAM101A (RFLNA) (NM_181709) Human Recombinant Protein

Sign In for Pricing
View Details
Dda1 Mouse shRNA Lentiviral Particle (Locus ID 66498)
TL519296V 500 µL Each

Dda1 Mouse shRNA Lentiviral Particle (Locus ID 66498)

Sign In for Pricing
View Details