Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CCL3 (C-C Motif Chemokine Ligand 3) protein, AF

C-C Motif Chemokine Ligand 3 (CCL3) is a 7.66 kDa cytokine with 69 amino acid residues. CCL3, also known as macrophage inflammatory protein 1-alpha (MIP-1-alpha), is expressed in the spleen, lung, and articular cartilage. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays a vital role in immune response, such as inflammation, recruitment of immune cells, and production of IL-1β and TNF. In addition, CCL3 also participates in resistance to type 1 virus infection, astrocyte cell migration, regulation of macromolecule metabolic process, and regulation of ERK1 and ERK2 cascade.

Product Specifications

Synonyms

MIP-1a: Macrophage Inflammatory Protein-1α, LD78α

Gene Name

CCL3

UniProt

P10855

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.69 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADAMDEC1 sgRNA gene knockout kit - Lentiviral human ADAMDEC1 sgRNA gene knockout kit (100)
GTR15369157 1 Vial

Lentiviral human ADAMDEC1 sgRNA gene knockout kit - Lentiviral human ADAMDEC1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TBC1D25 (NM_002536) Human Tagged Lenti ORF Clone
RC221238L4 10 µg

TBC1D25 (NM_002536) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TIGIT Human qPCR Primer Pair (NM_173799)
HP218496 200 Reactions

TIGIT Human qPCR Primer Pair (NM_173799)

Sign In for Pricing
View Details
Mouse SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
RE2244M-01 48 Tests

Mouse SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit

Sign In for Pricing
View Details
Mouse SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
RE2244M-02 96 Tests

Mouse SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit

Sign In for Pricing
View Details
GABA Receptor B R1 (Gamma-aminobutyric Acid Receptor Type B) (MaxLight 550)
MBS6477312-01 0.1 mL

GABA Receptor B R1 (Gamma-aminobutyric Acid Receptor Type B) (MaxLight 550)

Sign In for Pricing
View Details