Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-1 beta (Interleukin-1 beta) protein, AF

Interleukin-1 beta (IL-1β) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1β is cleaved by cytosolic caspase 1 to form mature IL-1β.

Product Specifications

Synonyms

Catabolin, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)

Gene Name

IL1B

UniProt

P10749

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is <8 pg/mL. The specific activity of recombinant mouse IL-1 beta is approximately >1.2x 108 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.3 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF488A conjugate, 0.1mg/mL
BNC882442-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXK2 Polyclonal Antibody
E-AB-52021-01 20 µL

FOXK2 Polyclonal Antibody

Sign In for Pricing
View Details
FOXK2 Polyclonal Antibody
E-AB-52021-02 60 µL

FOXK2 Polyclonal Antibody

Sign In for Pricing
View Details
FOXK2 Polyclonal Antibody
E-AB-52021-03 120 µL

FOXK2 Polyclonal Antibody

Sign In for Pricing
View Details
FOXK2 Polyclonal Antibody
E-AB-52021-04 200 µL

FOXK2 Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 3-Aminopyridine-2-carboxylate
TRC-E705505-1G 1 g

Ethyl 3-Aminopyridine-2-carboxylate

Sign In for Pricing
View Details