Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IL-7 (Interleukin-7) protein, AF

Interleukin-7 (IL-7) is a multipotent cytokine belonged to one of the members of IL-2 superfamily. IL-7 has diverse effects on the hematopoietic and immune regulations. IL-7 is a trophic factor that is necessary for both B cell and T cell proliferation and development. In addition, it presents potential antitumor effects in tumors such as glioma, melanoma, lymphoma, leukemia, prostate cancer, and glioblastoma.

Product Specifications

Synonyms

Lymphopoietin 1 (LP-1), pre-B-cell factor, hlb368, A630026I06Rik

Gene Name

IL7

UniProt

P10168

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC) . The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant mouse IL-7 is > 5 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.8 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL4 (NM_001144777) Human Over-expression Lysate
LC428517 20 µg

ELAVL4 (NM_001144777) Human Over-expression Lysate

Sign In for Pricing
View Details
PQBP1 (NM_001032382) Human Recombinant Protein
TP323994M 100 µg

PQBP1 (NM_001032382) Human Recombinant Protein

Sign In for Pricing
View Details
EFCAB4B (CRACR2A) (NM_032680) Human Recombinant Protein
TP319097 20 µg

EFCAB4B (CRACR2A) (NM_032680) Human Recombinant Protein

Sign In for Pricing
View Details
TAMRA-cAMP PDE IV substrate *Red Fluorescence*
13603-AAT 0.5 µmol

TAMRA-cAMP PDE IV substrate *Red Fluorescence*

Sign In for Pricing
View Details
Diethyl Benzylmalonate-d7
TRC-D124642-250MG 250 mg

Diethyl Benzylmalonate-d7

Sign In for Pricing
View Details
UBL5 (NM_024292) Human Over-expression Lysate
LC402981 20 µg

UBL5 (NM_024292) Human Over-expression Lysate

Sign In for Pricing
View Details