Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CCL3 (C-C motif chemokine ligand 3) protein, AF

C-C Motif Chemokine Ligand 3 (CCL3) is a 7.33Da cytokine with 66 amino acid residues. CCL3 is also called macrophage inflammatory protein 1-alpha (MIP-1-alpha) and is expressed in bone marrow and liver. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays an essential role in acute inflammatory responses like recruitment and activation of polymorphonuclear leukocytes and induction of monophasic fever. In addition, CCL3 participates in resistance to type 1 virus infection, mediation of MAPK signaling pathway, cell-cell signaling, and calcium-mediated signaling.

Product Specifications

Synonyms

MIP-1a: Macrophage Inflammatory Protein-1α, LD78α

Gene Name

CCL3

UniProt

P10147

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract human PBMC using a concentration range of 5 -50 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1xPBS, pH 8.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.4 kDa. The protein migrates as 8-11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA with polyhistidine tag at the N-terminus

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CEBP Beta Antibody [HRP]
NBP1-46179H 0.1 mL

Rabbit Polyclonal CEBP Beta Antibody [HRP]

Sign In for Pricing
View Details
2,3,3-Trimethyl-2-norbornyl Isothiocyanic Acid Ester
022457 100 mg

2,3,3-Trimethyl-2-norbornyl Isothiocyanic Acid Ester

Sign In for Pricing
View Details
CHST11 Rabbit Polyclonal Antibody
TA360438 100 µL

CHST11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Mannose-binding protein C (MBL2) ELISA Kit
AE34134RA-01 48 Tests

Rat Mannose-binding protein C (MBL2) ELISA Kit

Sign In for Pricing
View Details
Rat Mannose-binding protein C (MBL2) ELISA Kit
AE34134RA-02 96 Tests

Rat Mannose-binding protein C (MBL2) ELISA Kit

Sign In for Pricing
View Details
NeuroPeptide Y Receptor type 5 (NPY5R) Human ELISA Kit
F3612 96 Tests

NeuroPeptide Y Receptor type 5 (NPY5R) Human ELISA Kit

Sign In for Pricing
View Details