Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-8 (aa28-99) (Interleukin-8) protein, AF

Human IL-8 (aa 28-99) predicts a molecular mass of 8.5 kDa and is the 72 amino acid residue form Ser 28 to Ser 99 of mature human IL-8. This recombinant protein is the major form secreted by macrophages. IL-8 is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells.

Product Specifications

Synonyms

Monocyte-Derived Neutrophil Chemotactic Factor (MDNCF), Neutrophil Activating Factor (NAF), CXCL8, C-X-C motif chemokine ligand 8

Gene Name

CXCL8

UniProt

P10145

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract PBMC. The ED50 for this effect is <2 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.32 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rrh (NM_001107726) Rat Tagged Lenti ORF Clone
RR203236L3 10 µg

Rrh (NM_001107726) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Compound NP-024299
MBS5793041 Inquire

Compound NP-024299

Sign In for Pricing
View Details
KIF18A Polyclonal Antibody
MBS9134930-01 0.02 mL

KIF18A Polyclonal Antibody

Sign In for Pricing
View Details
KIF18A Polyclonal Antibody
MBS9134930-02 0.1 mL

KIF18A Polyclonal Antibody

Sign In for Pricing
View Details
KIF18A Polyclonal Antibody
MBS9134930-03 5x 0.1 mL

KIF18A Polyclonal Antibody

Sign In for Pricing
View Details
Fatty Acid Synthase (FASN) Rabbit mAb
MBS9147157-01 0.02 mL

Fatty Acid Synthase (FASN) Rabbit mAb

Sign In for Pricing
View Details