Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant Activin B protein, AF

Activin B is the cytokine of the TGF-beta family, which is a 13 kDa protein containing 115 amino acid residues. Activin B has the wide variety of biological function including stem cell differentiation, inflammation, bone remodeling and neural development. They also have a role in regulation of FSH secretion. Activin B induces the phosphorylation of Smad which binds the smad binding element.

Product Specifications

Synonyms

Activin Beta B, INHBB; inhibin beta B chain

Gene Name

INHBB

UniProt

P09529

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <0.7 ng/mL. The specific activity of recombinant human Activin B is > 1.5 x 106 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.75 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus.
More Discoveries

Explore Other Products

Browse additional items from our catalog

AGA Protein Vector (Mouse) (pPB-C-His)
PV152970 500 ng

AGA Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
PLV-CMV-MCS-mitoDsRed-Puro Plasmid
PVT65275 2 µg

PLV-CMV-MCS-mitoDsRed-Puro Plasmid

Sign In for Pricing
View Details
ACVRL1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61519R-BF350-01 20 µL

ACVRL1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ACVRL1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61519R-BF350-02 100 µL

ACVRL1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Grm5 Rat siRNA Oligo Duplex (Locus ID 24418)
SR501282 1 Kit

Grm5 Rat siRNA Oligo Duplex (Locus ID 24418)

Sign In for Pricing
View Details
CALY Protein Vector (Rat) (pPB-C-His)
PV257274 500 ng

CALY Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details