Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL1 (C-X-C motif chemokine 1) protein, AF

C-X-C motif chemokine 1 (CXCL1) also named Growth-regulated oncogene alpha (GROα), which is a chemokine of the intercrine alpha family. CXCL1 is a 7.9 kDa protein containing 73 amino acid residues. CXCL1 is expressed in immune cells such as macrophage and neutrophils. CXCL1 plays an important role with immune responses and cancer progression. CXCL1 activates the cell signal transduction with casepas1 that affect the cell proliferation, differentiation and migration.

Product Specifications

Synonyms

GRO-α: MGSAα, NAP-3, GRO1

Gene Name

CXCL1

UniProt

P09341

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <3 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.67 kDa. The protein migrates as 10 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mizoribine 5'-Monophosphate sodium salt
sc-484361 2.5 mg

Mizoribine 5'-Monophosphate sodium salt

Sign In for Pricing
View Details
Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit
MBS9319212-01 48 Well

Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit

Sign In for Pricing
View Details
Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit
MBS9319212-02 96 Well

Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit

Sign In for Pricing
View Details
Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit
MBS9319212-03 5x 96 Well

Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit

Sign In for Pricing
View Details
Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit
MBS9319212-04 10x 96 Well

Human Killer cell lectin-like receptor subfamily G member 1, KLRG1 ELISA Kit

Sign In for Pricing
View Details
PTMA Protein Lysate (Human) with C-Ha Tag
38114031 100 µg

PTMA Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details