Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant TGF beta 1 (Transforming growth factor beta 1) protein, AF

The transforming Growth Factors beta (TGF beta) family of cytokines are ubiquitous, multifunctional, and essential to survival. They play the central roles in growth, development, inflammation, repair, and host immunity. The mammalian TGF beta isoforms (TGF beta 1, beta 2 and beta 3) are secreted as potential precursors and possess a variety of cell surface receptors and produces at least two mediate signal transductions.

Product Specifications

Synonyms

Differentiation inhibiting factor, Cartilage-inducing factor, Tgfb-1

Gene Name

Tgfb1

UniProt

P04202/P17246

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile 10 mM HCl to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.8 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA1L polyclonal antibody
BS6629-01 50 µL

HSPA1L polyclonal antibody

Sign In for Pricing
View Details
HSPA1L polyclonal antibody
BS6629-02 100 µL

HSPA1L polyclonal antibody

Sign In for Pricing
View Details
Plant Lead ion channel (LIC) ELISA Kit
OM626428 96 Tests

Plant Lead ion channel (LIC) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal MCAM/CD146 Antibody (MCAM/1101) [Allophycocyanin]
NBP2-47776APC 0.1 mL

Mouse Monoclonal MCAM/CD146 Antibody (MCAM/1101) [Allophycocyanin]

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF574 Antibody
NB100-97825 100 µL

Rabbit Polyclonal ZNF574 Antibody

Sign In for Pricing
View Details
ZBED1 3'UTR Lenti-reporter-Luc Vector
50676081 1.0 µg

ZBED1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details