Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF

Granulocyte-macrophage colony-stimulating factor (GM-CSF) was first identified as a Growth Factors due to its ability to induce proliferation and differentiation of bone marrow progenitors into granulocytes and macrophages. GM-CSF is produced by multiple cell types including activated T cells, B cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. GM-CSF stimulates stem cells to produce granulocytes and monocytes functions as a cytokine.

Product Specifications

Synonyms

Colony stimulating factor 2, CSF2, CSF, Csfg, Csfgm, GMCS, GMCSF, Gm-CS, Gm-CSf, MGI-I, MGI-IGM

Gene Name

CSF2

UniProt

P01587

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in FDC-P1 cells. The ED50 for this effect is <50 pg/mL. The specific activity of recombinant mouse GM-CSF is approximately >2 x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 15.1 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Benzoylformate
TRC-E899995-5G 5 g

Ethyl Benzoylformate

Sign In for Pricing
View Details
FGFR4 Human Gene Knockout Kit (CRISPR)
KN204230BN 1 Kit

FGFR4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MerTK (Innate Immune Checkpoint) (MERTK/3022), CF568 conjugate, 0.1mg/mL
BNC683022-100 1x 100 µL

MerTK (Innate Immune Checkpoint) (MERTK/3022), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apolipoprotein CII (APOC2) (NM_000483) Human Over-expression Lysate
LC424693 20 µg

Apolipoprotein CII (APOC2) (NM_000483) Human Over-expression Lysate

Sign In for Pricing
View Details
CCR10 (NM_016602) Human Over-expression Lysate
LC402573 20 µg

CCR10 (NM_016602) Human Over-expression Lysate

Sign In for Pricing
View Details
LEF1 (NM_001130713) Human Over-expression Lysate
LC427260 20 µg

LEF1 (NM_001130713) Human Over-expression Lysate

Sign In for Pricing
View Details