Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IFN alpha 1a (Interferon alpha 1a) protein, AF

Interferon Alpha 1a (IFN alpha 1a) is a leukocyte interferon, which is a variant of Interferon-alpha. IFN-alpha 1a is a 18.4 kDa protein containing 166 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.

Product Specifications

Synonyms

Ifa, Ifa8

Gene Name

Ifna1

UniProt

P01572

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.93 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Soil DNA Isolation 96-Well Kit
26560 2 Plates

Soil DNA Isolation 96-Well Kit

Sign In for Pricing
View Details
TRIM9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]
TA800044AM 100 µL

TRIM9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details
S100A4 Rabbit Polyclonal Antibody
TA381216 100 µL

S100A4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF594 conjugate, 0.1mg/mL
BNC942250-500 1x 500 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Formyl Rifamycin
TRC-F700950-1G 1 g

3-Formyl Rifamycin

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), 0.2mg/mL
BNUB2338-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), 0.2mg/mL

Sign In for Pricing
View Details