Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant IFN alpha 1a (Interferon alpha 1a) protein, AF

Interferon Alpha 1a (IFN alpha 1a) is a leukocyte interferon, which is a variant of Interferon-alpha. IFN-alpha 1a is a 18.4 kDa protein containing 166 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.

Product Specifications

Synonyms

Ifa, Ifa8

Gene Name

Ifna1

UniProt

P01572

Reactivity

Mouse

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.93 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACBD7 (NM_001039844) Human Over-expression Lysate
LY421837 100 µg

ACBD7 (NM_001039844) Human Over-expression Lysate

Sign In for Pricing
View Details
Maleimide Coated - 96 well Solid plates - White PS
MCW22F-MAL 10x 96 Well Plates

Maleimide Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS708454 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
2-Cyano-3,3-diphenylacrylic Acid-d10
TRC-C718361-25MG 25 mg

2-Cyano-3,3-diphenylacrylic Acid-d10

Sign In for Pricing
View Details
Bax (2D2), CF405S conjugate, 0.1mg/mL
BNC040004-100 1x 100 µL

Bax (2D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SLAIN1 activation kit by CRISPRa
GA114766 1 Kit

Human SLAIN1 activation kit by CRISPRa

Sign In for Pricing
View Details