Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant TNF beta (Tumor necrosis factor beta) protein, AF

Human TNF beta (Lymphotoxin-alpha) is a 22 kDa cytokine with 205 amino acid residues. TNF beta belongs to tumor necrosis factor (TNF) superfamily as TNF alpha. Binding to lymphotoxin-β receptor (LtβR), canonical and non-canonical NF-κB signal pathway will be activated. TNF beta is related to apoptosis and inflammatory signals

Product Specifications

Synonyms

TNFSF1B, Lymphotoxin-alpha (LT-α), LTA

Gene Name

LTA

UniProt

P01374

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <3 pg/mL. The specific activity of recombinant human TNF beta is > 3.3x 108 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.65 kDa. The protein migrates as 21 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxyprogesterone ELISA Kit
K053-H1 1 Plate

Hydroxyprogesterone ELISA Kit

Sign In for Pricing
View Details
3-Aminophthalic Acid Hydrochloride Dihydrate, Technical Grade
TRC-A627710-1G 1 g

3-Aminophthalic Acid Hydrochloride Dihydrate, Technical Grade

Sign In for Pricing
View Details
Mouse IgG3 Isotype Control for In Vivo - Low Endotoxin (MG3-35) [ICH2249]
ICH2249-25mg 25 mg

Mouse IgG3 Isotype Control for In Vivo - Low Endotoxin (MG3-35) [ICH2249]

Sign In for Pricing
View Details
4-Ethylphenyl-d4 Sulfate Potassium Salt
TRC-E925867-25MG 25 mg

4-Ethylphenyl-d4 Sulfate Potassium Salt

Sign In for Pricing
View Details
5-Amino-1-Beta-D-ribofuranosyl-1H-imidazole-4-carboxylic Acid Sodium Salt
TRC-A629225-25MG 25 mg

5-Amino-1-Beta-D-ribofuranosyl-1H-imidazole-4-carboxylic Acid Sodium Salt

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS804689 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details