Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant EGF (Epidermal growth factor) protein, AF

Epidermal Growth Factors (EGF) is a member of the EGF-family of proteins. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epithelial cells, play important roles in many developmental processes including accelerate tooth eruption, inhibits gastric acid secretion, and involve in wound healing.

Product Specifications

Synonyms

Urogastrone, URG

Gene Name

EGF

UniProt

P01132

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <80 pg/mL. The specific activity of recombinant mouse EGF is approximately >1 x 107 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 6.98 kDa. The protein migrates as 8 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit
abx196781-01 96 Tests

Mouse Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit

Sign In for Pricing
View Details
Mouse Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit
abx196781-02 5x 96 Tests

Mouse Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit

Sign In for Pricing
View Details
Mouse Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit
abx196781-03 10x 96 Tests

Mouse Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit

Sign In for Pricing
View Details
Phospho-ALK (Tyr1278 + Tyr1282 + Tyr1283) Polyclonal Antibody, PE-Cy7 Conjugated
bs-3021R-PE-Cy7 100 µL

Phospho-ALK (Tyr1278 + Tyr1282 + Tyr1283) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
HCN2 Polyclonal Antibody
MBS2527902-01 0.02 mL

HCN2 Polyclonal Antibody

Sign In for Pricing
View Details
HCN2 Polyclonal Antibody
MBS2527902-02 0.06 mL

HCN2 Polyclonal Antibody

Sign In for Pricing
View Details