Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-33 (Interleukin-33) protein, AF

Interleukin 33 (IL-33) is an 18 kDa cytokine with 169 amino acid residues. Interleukin-33 is a member of the IL-1 cytokine family and is primarily expressed in endothelial cells, epithelial cells, fibroblasts, and mesenchymal cells. When IL-33 binds to its receptor, ST2L, it activates mast cells and innate lymphoid cells and subsequently generates IL-5 and IL-13, which play essential roles in allergic inflammation. IL-33 also acts as an alarm by alerting the immune system of cellular damage and plays a critical role in type-2 innate immunity.

Product Specifications

Synonyms

IL-1 F11, NF-HEV, DVS27

Gene Name

IL33

UniProt

O95760

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to binding with recombinant ST2L (IL-33 receptor) . The ED50 for this effect is <54 ng/mL. Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is < 0.1 ng/mL. The specific activity of recombinant human IL-33 is approximately >4 x107 IU/ mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.93 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP Antibody
MBS9200429-01 0.08 mL

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
MBS9200429-02 0.4 mL

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
MBS9200429-03 5x 0.4 mL

GFAP Antibody

Sign In for Pricing
View Details
Lypd1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7324103 1.0 µg DNA

Lypd1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human DMBT1 Pre-designed siRNA Set B
SI004351B 1 Each

Human DMBT1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
DOCK2 (NM_004946) Human Tagged ORF Clone
RC211198 10 µg

DOCK2 (NM_004946) Human Tagged ORF Clone

Sign In for Pricing
View Details