Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-33 (Interleukin-33) protein, AF

Interleukin 33 (IL-33) is an 18 kDa cytokine with 169 amino acid residues. Interleukin-33 is a member of the IL-1 cytokine family and is primarily expressed in endothelial cells, epithelial cells, fibroblasts, and mesenchymal cells. When IL-33 binds to its receptor, ST2L, it activates mast cells and innate lymphoid cells and subsequently generates IL-5 and IL-13, which play essential roles in allergic inflammation. IL-33 also acts as an alarm by alerting the immune system of cellular damage and plays a critical role in type-2 innate immunity.

Product Specifications

Synonyms

IL-1 F11, NF-HEV, DVS27

Gene Name

IL33

UniProt

O95760

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to binding with recombinant ST2L (IL-33 receptor) . The ED50 for this effect is <54 ng/mL. Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is < 0.1 ng/mL. The specific activity of recombinant human IL-33 is approximately >4 x107 IU/ mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.93 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC14B Antibody
MBS9429588-01 0.1 mL

CDC14B Antibody

Sign In for Pricing
View Details
CDC14B Antibody
MBS9429588-02 5x 0.1 mL

CDC14B Antibody

Sign In for Pricing
View Details
Recombinant Human FOLR1 Protein
ARP2142-01 10 µg

Recombinant Human FOLR1 Protein

Sign In for Pricing
View Details
Recombinant Human FOLR1 Protein
ARP2142-02 50 µg

Recombinant Human FOLR1 Protein

Sign In for Pricing
View Details
Recombinant Human FOLR1 Protein
ARP2142-03 100 µg

Recombinant Human FOLR1 Protein

Sign In for Pricing
View Details
Recombinant Human FOLR1 Protein
ARP2142-04 1 mg

Recombinant Human FOLR1 Protein

Sign In for Pricing
View Details