Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant BMP-11 (Bone morphogenetic protein-11) protein, AF

Bone Morphogenetic Protein-11 (BMP-11), known as Growth differentiation factor 11 (GDF11), is an extracellular multifunctional signaling cytokine that is also a member of the TGFβ family. BMP-11 can bind with the TGFβ receptor and is involved in SMAD protein signal transduction. Moreover, it promotes the formation of blood vessels and nerves that can control anterior-posterior patterning.

Product Specifications

Synonyms

Growth/Differentiation Factor-11, GDF-11

Gene Name

GDF11

UniProt

O95390

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <11 ng/mL. Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <4 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.40 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2N1 (C-term) Rabbit Polyclonal Antibody
AP50718PU-N 400 µL

CAMK2N1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-10315-01 20 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-10315-02 60 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-10315-03 120 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
RDX Polyclonal Antibody
E-AB-10315-04 200 µL

RDX Polyclonal Antibody

Sign In for Pricing
View Details
CSNK1G3 (NM_001044722) Human Over-expression Lysate
LY420831 100 µg

CSNK1G3 (NM_001044722) Human Over-expression Lysate

Sign In for Pricing
View Details