Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant FGF-18 (Fibroblast growth factor-18) protein, AF

Fibroblast Growth Factors-18 (FGF-18) is a 24 kDa member of the fibroblast Growth Factors with 207 amino acid residues. FGF-18 is mainly expressed from glandular and luminal cells, cardiomyocytes, breast myoepithelial cells and endometrial ciliated cells. FGF-18 involved cell proliferation, cell differentiation and cell migration. FGF-18 is an important role in skeletal growth and development, stimulates hepatic and intestinal proliferation.

Product Specifications

Synonyms

FGFI, zFGF5

Gene Name

FGF18

UniProt

O76093

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.3-2.0 ng/mL. The specific activity of recombinant human FGF-18 is > 5 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 21.11 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuicKey Pro Rabbit Cortisol ELISA Kit
E-OSEL-RB0002-01 24 Tests

QuicKey Pro Rabbit Cortisol ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rabbit Cortisol ELISA Kit
E-OSEL-RB0002-02 48 Tests

QuicKey Pro Rabbit Cortisol ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rabbit Cortisol ELISA Kit
E-OSEL-RB0002-03 96 Tests

QuicKey Pro Rabbit Cortisol ELISA Kit

Sign In for Pricing
View Details
SFTA2 (NM_205854) Human Over-expression Lysate
LC404203 20 µg

SFTA2 (NM_205854) Human Over-expression Lysate

Sign In for Pricing
View Details
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI10B3]
CF812311 100 µg

Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI10B3]

Sign In for Pricing
View Details
MIR3132 Human qPCR Primer Pair (MI0014152)
HP300741 200 Reactions

MIR3132 Human qPCR Primer Pair (MI0014152)

Sign In for Pricing
View Details