Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF

TNF-related Weak Inducer of Apoptosis (TWEAK) is a type II membrane protein of the tumor necrosis factor (TNF) family members, high levels expression in mouse peritoneal macrophages. The murine and human TWEAK homologs are very close related (~93% sequence identity in the receptor-binding domain) . TWEAK is a 17.3 kDa protein containing 129 residues. TWEAK induce apoptosis through cognate receptor Fn14 activate caspase-8 and caspase-3, in HSC3 cells KATO-III gastric adenocarcinoma cells and IFN-γ-treated HT-29. TWEAK stimulate inflammatory cytokines in HT-29, A375 cells, WI-38 fibroblast sand astrocytes.

Product Specifications

Synonyms

TNFSF12, DR3LG, Apo3 Ligand, AI255180, C87282, Fn1, Fn14, HPIP, TWEAK-R, Twea, TweakR, Tnfrsf12a

Gene Name

TNFSF12

UniProt

O54907

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <0.2 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.14 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homer2 Rabbit Polyclonal Antibody
HA500538 100 µL

Homer2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-Ra-01 96 Tests

Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-Ra-02 48 Tests

Rat Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
Mouse Chek1 activation kit by CRISPRa
GA200713 1 Kit

Mouse Chek1 activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details