Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

C-X-C motif chemokine 13 (CXCL13) also named B lymphocyte chemoattractant (BLC), which is a chemokine of the intercrine alpha family. CXCL13 is a 7.9kDa protein containing 72 amino acid residues. CXCL13 is a chemotaxis for B lymphocyte. CXCL13 induces the cell proliferation though the AKT signal pathway which plays a key role intestinal cancer model. CXCL13 /CXCR5 axis is highly existed in gut, spleen and lymph nodes.

Product Specifications

Synonyms

B-cell Attracting Chemokine-1, BLR1 Ligand, BCA-1/BLC

Gene Name

CXCL13

UniProt

O43927

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR5. The ED50 for this effect is <20 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 9.49 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR with polyhistidine tag at the N-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scara5 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6590204 1.0 µg DNA

Scara5 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
ANGPT2 Antibody, Biotin conjugated
A41284-50UG 50 µg

ANGPT2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-Homo sapiens (Human) WDR1 Polyclonal Antibody
MBS7142937 Inquire

Rabbit anti-Homo sapiens (Human) WDR1 Polyclonal Antibody

Sign In for Pricing
View Details
TCF3 Rabbit pAb (APR29270N)
APR29270N-01 50 µL

TCF3 Rabbit pAb (APR29270N)

Sign In for Pricing
View Details
TCF3 Rabbit pAb (APR29270N)
APR29270N-02 100 µL

TCF3 Rabbit pAb (APR29270N)

Sign In for Pricing
View Details
TCF3 Rabbit pAb (APR29270N)
APR29270N-03 200 µL

TCF3 Rabbit pAb (APR29270N)

Sign In for Pricing
View Details