Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant FGF-10 (Fibroblast growth factor-10) protein, AF

Fibroblast Growth Factors-10 (FGF-10) is a 23.4 kDa member of the fibroblast Growth Factors with 208 amino acid residues. FGF-10 is mainly secreted from endometrial stromal cells, fibroblasts, peritubular cells, leydig cells, muller glia cells. FGF-10 a multifunctional mesenchymal-epithelial signaling Growth Factors, can regulate embryonic development, cell proliferation and cell differentiation. It has been associated with cancer and human genetic disorders.

Product Specifications

Synonyms

FGFA, Keratinocyte Growth Factor-2

Gene Name

FGF10

UniProt

O15520

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <8 ng/mL. The specific activity of recombinant human FGF-10 is > 1.2 x 105 IU/mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 20.06 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Izastobart) Biosimilar Reference Antibody
orb3158623-01 100 µg

(Izastobart) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Izastobart) Biosimilar Reference Antibody
orb3158623-02 1 mg

(Izastobart) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Izastobart) Biosimilar Reference Antibody
orb3158623-03 5 mg

(Izastobart) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Izastobart) Biosimilar Reference Antibody
orb3158623-04 10 mg

(Izastobart) Biosimilar Reference Antibody

Sign In for Pricing
View Details
GCP2 (CXCL6) (NM_002993) Human Untagged Clone
SC118268 10 µg

GCP2 (CXCL6) (NM_002993) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Toll Like Receptor 7 (TLR7)
RPU57042-01 50 µg

Recombinant Toll Like Receptor 7 (TLR7)

Sign In for Pricing
View Details