Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant Galectin-9 protein, AF

Galectin-9 (Gal-9) is a lectin family member and is one of the tandem repeat-type galectins containing two carbohydrate recognition domains (CRD) connected by a linker region in a single peptide chain. The CRD is responsible for β-galactoside binding, and several binding partners for galectin-9 have been identified, including CD44, FGL, Gcgr, GLUT- 2, IgE, IgM, PDI, and Tim-3. Galectin-9 is constitutively presented in the small intestine, liver, uterine epithelial cells, skin epidermis, and esophageal epithelium. Galectin-9 contributing to cell growth, differentiation, adhesion, communication, and death. Accumulated evidence indicates that Gal-9 blockade promotes T cell immunity against tumors, suggesting that galectin-9 is a promising target for immunotherapy.

Product Specifications

Synonyms

LGALS9, HUATA, LGALS9

Gene Name

LGALS9

UniProt

O00182

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED50 for this effect is <3 μg/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 36.7 kDa. The protein migrates as 37 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+) -UH 232
HY-111006 1 Each

(+) -UH 232

Sign In for Pricing
View Details
Lentiviral human EDDM13 sgRNA gene knockout kit - Lentiviral human EDDM13 sgRNA gene knockout kit (plasmid)
GTR15373493 1 Vial

Lentiviral human EDDM13 sgRNA gene knockout kit - Lentiviral human EDDM13 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CheKine Micro Soil Neutral Invertase (S-NI) Activity Assay Kit
orb3148386-01 48 Tests

CheKine Micro Soil Neutral Invertase (S-NI) Activity Assay Kit

Sign In for Pricing
View Details
CheKine Micro Soil Neutral Invertase (S-NI) Activity Assay Kit
orb3148386-02 96 Tests

CheKine Micro Soil Neutral Invertase (S-NI) Activity Assay Kit

Sign In for Pricing
View Details
GCP2 antibody
70R-GR017 0.05 mg

GCP2 antibody

Sign In for Pricing
View Details
Anti-Histone Deacetylase 7 Antibody
CPA2674-01 30 µL

Anti-Histone Deacetylase 7 Antibody

Sign In for Pricing
View Details