Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-15 protein, GMP

Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.

Product Specifications

Synonyms

IL-T

Gene Name

IL15

UniProt

P40933

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell culture, ELISA

Purification

>95% as determined by SDS-PAGE analysis.

Endotoxin

<0.05 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in CTLL-2 cells. The ED50 for this effect is < 3 ng/mL. The specific activity of recombinant human IL-15 is > 2 x 106 IU/mg, which is calibrated against the human IL-15 WHO International Standard (NIBSC code: 95/554) .

Form

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.

Molecular Weight

The protein has a calculated MW of 13.7 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFIN TSLE with polyhistidine tag at the N-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNC1I2 Rabbit Polyclonal Antibody
TA375666 100 µL

DYNC1I2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C14orf184 Human Gene Knockout Kit (CRISPR)
KN416631 1 Kit

C14orf184 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IL-1RAcP/IL-1R3 Protein (His Tag)
PKSH031857 100 µg

Recombinant Human IL-1RAcP/IL-1R3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant TR AP Antibody
RC-16879-01 50 μL

Recombinant TR AP Antibody

Sign In for Pricing
View Details
Recombinant TR AP Antibody
RC-16879-02 100 µL

Recombinant TR AP Antibody

Sign In for Pricing
View Details
Recombinant TR AP Antibody
RC-16879-03 1 mL

Recombinant TR AP Antibody

Sign In for Pricing
View Details