Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant CXCL12 (C-X-C motif chemokine 12) protein, AF

C-X-C motif chemokine 12 (CXCL12) also named stromal cell-derived factor 1 (SDF-1), which is a chemokine of the intercrine alpha family. CXCL12 is a 7.8 kDa protein containing 70 amino acid residues. CXCL12 has a key role in controling the immune responses which is often induced by the lipopolysaccharide or IL-1. CXCL12 also activates the leukocytes during inflammation. CXCL12 induces the migration and proliferation of cells like hematopoietic progenitor, stem cells and leukocytes.

Product Specifications

Synonyms

PB, PBSF/SD, Pbsf, SDF-, Scyb1, Scyb12, Sdf, Sdf1, TLS, TP, Tlsf, Tpar1

Gene Name

CXCL12

UniProt

P40224

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED50 for this effect is <0.5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 8.97 kDa. The protein migrates below 8-11 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK with polyhistidine tag at the C-terminus.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL40 Antibody
abx014130-01 10 µg

RPL40 Antibody

Sign In for Pricing
View Details
RPL40 Antibody
abx014130-02 100 µg

RPL40 Antibody

Sign In for Pricing
View Details
RPL40 Antibody
abx014130-03 200 µg

RPL40 Antibody

Sign In for Pricing
View Details
RPL40 Antibody
abx014130-04 300 µg

RPL40 Antibody

Sign In for Pricing
View Details
RPL40 Antibody
abx014130-05 1 mg

RPL40 Antibody

Sign In for Pricing
View Details
LYZL1 (C-Term) Rabbit pAb
MBS8553229-01 0.1 mL

LYZL1 (C-Term) Rabbit pAb

Sign In for Pricing
View Details