Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-13 (Interleukin-13) protein, AF

Interleukin 13 (IL-13) with a molecular mass of 10 kDa cytokine, it secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. It is homologous to IL-4 and shares many of its biologic activities on mononuclear phagocytic cells, endothelial cells, epithelial cells, and B cells.

Product Specifications

Synonyms

NC30

Gene Name

IL13

UniProt

P35225

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>95% as determined by SDS-PAGE.

Endotoxin

<0.01 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is<0.8 ng/mL. The specific activity of recombinant human IL-13 is approximately >1 x106 IU/ mg.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.28 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein CI (APOC1) (NM_001645) Human Recombinant Protein
TP308888L 1 mg

Apolipoprotein CI (APOC1) (NM_001645) Human Recombinant Protein

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-603
BCPS-603 1 Unit

Large Capacity Water Purification System BCPS-603

Sign In for Pricing
View Details
Tek Mouse Gene Knockout Kit (CRISPR)
KN517397 1 Kit

Tek Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Crude Vicia graminea Lectin -VGA-
L-4400-2 2 mL

Crude Vicia graminea Lectin -VGA-

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS641443 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
KEL Mouse Monoclonal Antibody [Clone ID: OTI5E6]
CF811547 100 µg

KEL Mouse Monoclonal Antibody [Clone ID: OTI5E6]

Sign In for Pricing
View Details