Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse recombinant MIF (Macrophage migration inhibitory factor) protein, AF

Macrophage Migration Inhibitory Factor (MIF) is a 12 kDa cytokine with 115 amino acid residues. When MIF binding to CD74 and CD44, downstream signaling pathway (like ERK, AKT and MAPK) will be activated and cause p53 inhibition, cancer proliferation and invasion.

Product Specifications

Synonyms

GLIF, mMIF, GIF, Glycosylation-inhibiting factor, DER6

Gene Name

Mif

UniProt

P34884

Reactivity

Mouse

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Testing in process

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 13.31 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig CC Chemokine Receptor 5 ELISA Kit
MBS729612-01 48 Well

Guinea pig CC Chemokine Receptor 5 ELISA Kit

Sign In for Pricing
View Details
Guinea pig CC Chemokine Receptor 5 ELISA Kit
MBS729612-02 96 Well

Guinea pig CC Chemokine Receptor 5 ELISA Kit

Sign In for Pricing
View Details
Guinea pig CC Chemokine Receptor 5 ELISA Kit
MBS729612-03 5x 96 Well

Guinea pig CC Chemokine Receptor 5 ELISA Kit

Sign In for Pricing
View Details
Guinea pig CC Chemokine Receptor 5 ELISA Kit
MBS729612-04 10x 96 Well

Guinea pig CC Chemokine Receptor 5 ELISA Kit

Sign In for Pricing
View Details
Phospho-VEGF receptor 2 (Tyr1059) Rabbit Polyclonal Antibody (BF594)
orb1576175 100 µL

Phospho-VEGF receptor 2 (Tyr1059) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
TP73 (Tumor Protein p73)
494365 100 µL

TP73 (Tumor Protein p73)

Sign In for Pricing
View Details