Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant CD27L (CD27 ligand) protein, AF

Human CD27L is also named for CD70 which is one member of TNF family. Human CD27L is expressed on T and B lymphocytes and mature DCs. It binds the CD27, which is on the antigen-presenting cells. Human CD27L is a 23 kDa cytokine with 154 amino acid residues which is a transmembrane glycoprotein. Human CD27L plays an important role in the regulation of T cell proliferation which is also a good target of cancer immunotherapy.

Product Specifications

Synonyms

Soluble CD27 Ligand, sCD27 Ligand, TNFSF7, CD70

Gene Name

CD70

UniProt

P32970

Reactivity

Human

Tag

His Tag (N-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.6 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing containing 0.05% sarkosyl, in 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 18.08 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP with polyhistidine tag at the N-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLGF (PGF) Rabbit Polyclonal Antibody
TA364547 100 µL

PLGF (PGF) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit
E-CL-H0075-01 24 Tests

Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit

Sign In for Pricing
View Details
Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit
E-CL-H0075-02 48 Tests

Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit

Sign In for Pricing
View Details
Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit
E-CL-H0075-03 96 Tests

Human Flt3L (FMS Like Tyrosine Kinase 3 Ligand) CLIA Kit

Sign In for Pricing
View Details
Recombinant Mouse SCPEP1/RISC Protein (His Tag)
PKSM040327 100 µg

Recombinant Mouse SCPEP1/RISC Protein (His Tag)

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F11330-01 100 µg

AF/LE Purified Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details