Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine recombinant IL-2 (Interleukin-2) protein, AF

Interleukin-2 (IL-2) is a four bundle, immuno-modulatory cytokine which is expressed predominately by antigen-simulated CD4+ T cells, CD8+ T cells, natural killer (NK) cells, and dendritic cells (DC) . IL-2 plays a fundamental role in promoting NK cell proliferation, cytotoxicity, and B cells differentiation. IL-2 modulate T cell differentiation programs, promoting na?ve CD4+ T cell differentiation into T helper-1 (Th1) and T helper-2 (Th2) cells.

Product Specifications

Synonyms

T-cell Growth Factor (TCGF), Aldesleukin, POIL2

Gene Name

IL2

UniProt

P26891

Reactivity

Swine

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce proliferation in CTLL2 cells. The ED50 for this effect is 0.5 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 16.2 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT with polyhistidine tag at the C-terminus

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF405S conjugate, 0.1mg/mL
BNC043632-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (rCDX2/1690), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Akr1b8 Mouse Gene Knockout Kit (CRISPR)
KN501086 1 Kit

Akr1b8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse BTNL2/Butyrophilin-like Protein 2 Protein (His Tag)
PKSM041354-01 10 µg

Recombinant Mouse BTNL2/Butyrophilin-like Protein 2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse BTNL2/Butyrophilin-like Protein 2 Protein (His Tag)
PKSM041354-02 50 µg

Recombinant Mouse BTNL2/Butyrophilin-like Protein 2 Protein (His Tag)

Sign In for Pricing
View Details
Human WDR43 activation kit by CRISPRa
GA108082 1 Kit

Human WDR43 activation kit by CRISPRa

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)
RAF-007-2 2 mL

TRITC Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)

Sign In for Pricing
View Details